PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS70807.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MIKC_MADS
Protein Properties Length: 256aa    MW: 29160.9 Da    PI: 8.0033
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS70807.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.71.1e-31959151
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  EPS70807.1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                79***********************************************96 PP

2K-box86.45.6e-29791745100
       K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                 + ++  ++ ++s+++e+ kLk+++e+Lq+ qR+llG+dL+ L+l++L+++e+qL++slk iRs++++++l+q+++lq kek + ++nk+L++klee
  EPS70807.1  79 EVNNPGKEIEQSSYKEYLKLKSKYETLQQYQRQLLGDDLGALNLNDLESIEHQLDSSLKLIRSTRTQIMLDQLSDLQTKEKLMVDANKSLERKLEE 174
                 55666777889**********************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.515161IPR002100Transcription factor, MADS-box
CDDcd002654.35E-45278No hitNo description
SuperFamilySSF554553.01E-34283IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-333859IPR002100Transcription factor, MADS-box
PfamPF014862.2E-2486172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.3988178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0048481Biological Processplant ovule development
GO:0071486Biological Processcellular response to high light intensity
GO:0071492Biological Processcellular response to UV-A
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS  60
SNMLKTLERY QKCSYGSLEV NNPGKEIEQS SYKEYLKLKS KYETLQQYQR QLLGDDLGAL  120
NLNDLESIEH QLDSSLKLIR STRTQIMLDQ LSDLQTKEKL MVDANKSLER KLEEIYAATH  180
HQLQQQSWLG GVGGQQSNSF GGHHQNNHHH HGFFQPLDCN STLQIGYNDQ VSSEQITAAA  240
AADSQNVNGL VPIWML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-30751721101Developmental protein SEPALLATA 3
4ox0_B3e-30751721101Developmental protein SEPALLATA 3
4ox0_C3e-30751721101Developmental protein SEPALLATA 3
4ox0_D3e-30751721101Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099041.11e-149PREDICTED: developmental protein SEPALLATA 1 isoform X2
SwissprotP293841e-113SEP2_ARATH; Developmental protein SEPALLATA 2
TrEMBLS8EDZ40.0S8EDZ4_9LAMI; Uncharacterized protein
STRINGSolyc02g089200.2.11e-124(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.13e-87MIKC_MADS family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]